DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Ascl4

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_038935995.1 Gene:Ascl4 / 299687 RGDID:1307533 Length:145 Species:Rattus norvegicus


Alignment Length:125 Identity:44/125 - (35%)
Similarity:64/125 - (51%) Gaps:38/125 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKIS 147
            ||.||      .|.:...:::||.|||.||:.||..:||||||:|:.:           ..:::|
  Rat    49 SLPPG------GVAEPAFLRQRNERERQRVRCVNEGYARLRQHLPREL-----------AGQRLS 96

  Fly   148 KVDTLRIAVEYIRRLQDLVD----DLNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSS 203
            ||:|||.|:.||::||:|::    |||.                 |..|..||.:|.|||
  Rat    97 KVETLRAAIGYIKQLQELLERHRPDLNS-----------------DGESKASSGASPCSS 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 24/57 (42%)
Ascl4XP_038935995.1 bHLH_SF 57..116 CDD:412148 28/69 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12323
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.