DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and PTF1A

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_835455.1 Gene:PTF1A / 256297 HGNCID:23734 Length:328 Species:Homo sapiens


Alignment Length:261 Identity:65/261 - (24%)
Similarity:102/261 - (39%) Gaps:85/261 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PGGNQNQPAGTMPIKTRKYTPRGMALTRCSESVSSLSPGSSPAP-------YNVDQSQSVQRRNA 106
            |||....|..  |.....|...|.|:......:..||..::.|.       ...:..|..|..|.
Human   108 PGGFPYSPGS--PPSCLAYPCAGAAVLSPGARLRGLSGAAAAAARRRRRVRSEAELQQLRQAANV 170

  Fly   107 RERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPH-KKISKVDTLRIAVEYIRRLQDLVD-DL 169
            |||.|::.:|::|..||.|||..            |: |::|||||||:|:.||..|.:||. ||
Human   171 RERRRMQSINDAFEGLRSHIPTL------------PYEKRLSKVDTLRLAIGYINFLSELVQADL 223

  Fly   170 -------------NGGSNIGANNAVTQLQ---LCLDESSSHSSSSSTCSS---------SGHNTY 209
                         .||..:|.::..:|.|   :|      |..:.|...|         :||:..
Human   224 PLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIIC------HRGTRSPSPSDPDYGLPPLAGHSLS 282

  Fly   210 YQNTISVSPLQQQQQLQRQQFNHQPLTALSLNTNLVGTSVPGGDAGCVSTSKNQQTCHSPTSSFN 274
            :.:         ::||:.|              |::.|:.       |.|.::.:..:| .||||
Human   283 WTD---------EKQLKEQ--------------NIIRTAK-------VWTPEDPRKLNS-KSSFN 316

  Fly   275 S 275
            :
Human   317 N 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 24/58 (41%)
PTF1ANP_835455.1 HLH 165..220 CDD:238036 27/66 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..278 2/18 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.