DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Ascl2

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_113691.1 Gene:Ascl2 / 24209 RGDID:2159 Length:260 Species:Rattus norvegicus


Alignment Length:186 Identity:66/186 - (35%)
Similarity:87/186 - (46%) Gaps:47/186 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 APSP----------LIPGG-------NQNQPAGTMPIKTRKYTPRGMALTRCSESVSSLSPGSSP 90
            ||.|          |:.||       ..:..||....:.|..:|.   |.|||....|   |::.
  Rat    54 APKPVAGAPALNASLMDGGALPRLVPTSSGVAGACTARRRPPSPE---LLRCSRRRRS---GATE 112

  Fly    91 APYNVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIA 155
            |.   ..|.:|.|||.|||||||.||..|..||||:|..           |.:||:|||:|||.|
  Rat   113 AS---SSSAAVARRNERERNRVKLVNLGFQALRQHVPHG-----------GANKKLSKVETLRSA 163

  Fly   156 VEYIRRLQDLVDD-------LNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSSS 204
            |||||.||.|:.:       |:||.   ...|.....:|...|:|.:|:|.:|:|:
  Rat   164 VEYIRALQRLLAEHDAVRAALSGGL---LTPATRPSDVCTQPSASPASASLSCTST 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 31/57 (54%)
Ascl2NP_113691.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..126 16/49 (33%)
HLH 134..176 CDD:197674 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..239 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352170
Domainoid 1 1.000 67 1.000 Domainoid score I9554
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5061
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm9108
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.850

Return to query results.
Submit another query.