DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Ptf1a

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_061279.2 Gene:Ptf1a / 19213 MGIID:1328312 Length:324 Species:Mus musculus


Alignment Length:276 Identity:67/276 - (24%)
Similarity:103/276 - (37%) Gaps:97/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IMPAPS--------PLIPGGNQNQP---------AGTMPIKTRKYTPRGMALTRCSESVSSLSPG 87
            :.||||        |  |.|:..:|         ||. |:....|:|............:.||||
Mouse    70 LQPAPSAAPHALAPP--PLGDPGEPEDNVSYCCDAGA-PLAAFPYSPGSPPSCLAYPCAAVLSPG 131

  Fly    88 SSPAPYNVDQSQSVQRR-----------------NARERNRVKQVNNSFARLRQHIPQSIITDLT 135
            :.....|...:.:..||                 |.|||.|::.:|::|..||.|||..      
Mouse   132 ARLGGLNGAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTL------ 190

  Fly   136 KGGGRGPH-KKISKVDTLRIAVEYIRRLQDLVD-DL-------------NGGSNIGANNAVTQLQ 185
                  |: |::|||||||:|:.||..|.:||. ||             .|..::|.::...|.|
Mouse   191 ------PYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGAGGCGGPGGSRHLGEDSPGNQAQ 249

  Fly   186 ---LCLDESSSHSSSSSTCSS---------SGHNTYY--------QNTISVSPL---QQQQQLQR 227
               :|      |..:.|...|         :||:..:        ||.|..:.:   :..::|..
Mouse   250 KVIIC------HRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNS 308

  Fly   228 QQF----NHQPLTALS 239
            :.|    |..|...:|
Mouse   309 KSFDNIENEPPFEFVS 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 24/58 (41%)
Ptf1aNP_061279.2 HLH 162..217 CDD:238036 26/66 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..324 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.