Sequence 1: | NP_476803.1 | Gene: | sc / 30982 | FlyBaseID: | FBgn0004170 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505401.2 | Gene: | hlh-10 / 191402 | WormBaseID: | WBGene00001954 | Length: | 202 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 46/195 - (23%) |
---|---|---|---|
Similarity: | 80/195 - (41%) | Gaps: | 56/195 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 MSSSVLSTNETFPTTINSA----TKIFRYQHIMPAPSPLIPGGNQN----------QPAGTMPIK 63
Fly 64 TRKYTPRGMA----LTRCSESVSSLSPGSSPAPYNVDQSQSVQRR-------------------- 104
Fly 105 -NARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDD 168
Fly 169 168 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sc | NP_476803.1 | HLH | 105..163 | CDD:278439 | 24/57 (42%) |
hlh-10 | NP_505401.2 | bHLH_SF | 121..179 | CDD:381792 | 25/70 (36%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |