DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and hlh-6

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_496070.1 Gene:hlh-6 / 188539 WormBaseID:WBGene00001952 Length:268 Species:Caenorhabditis elegans


Alignment Length:174 Identity:49/174 - (28%)
Similarity:79/174 - (45%) Gaps:50/174 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PLIPGGNQNQPAGTMPIKT-----RKYTPRGMALTRCSESVSSLSPGSS-PAPYNVDQ-----SQ 99
            |.:|..:|.:|:....:.|     :||             |:..:|.:: |.|..::.     |.
 Worm   122 PQLPTQSQPKPSSKASLDTSSNAFKKY-------------VNPFAPEATVPLPVELEDQYGPYSS 173

  Fly   100 SVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQD 164
            ||.:||.|||.||:.||:.:.|||:|:|...           ..|:||||||||:|:.||:.|.:
 Worm   174 SVWKRNERERCRVRNVNDGYERLRKHLPVHF-----------DEKRISKVDTLRLAIRYIKHLDN 227

  Fly   165 LVDD---------LNGGSNIGANNAVTQLQLCLDESSSHSSSSS 199
            |:..         .||.......|      :.:|.|:.:.:||:
 Worm   228 LLRSELHQYNCKCFNGFQEESEGN------ILIDISTFNFNSSN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 25/57 (44%)
hlh-6NP_496070.1 HLH 179..231 CDD:197674 27/62 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14646
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.