DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and hlh-19

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_508119.2 Gene:hlh-19 / 186449 WormBaseID:WBGene00001962 Length:111 Species:Caenorhabditis elegans


Alignment Length:76 Identity:26/76 - (34%)
Similarity:41/76 - (53%) Gaps:12/76 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 SVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQD 164
            |.:|.|||||.|.|.:.|:|..||.|:|:.:           ..:|.||.:||:.|.:||..|..
 Worm     2 SRERANARERCRQKSIGNAFNMLRNHLPKQL-----------RDRKPSKAETLKSAAQYISHLLR 55

  Fly   165 LVD-DLNGGSN 174
            ::: ::...||
 Worm    56 ILEKEIENSSN 66

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 21/57 (37%)
hlh-19NP_508119.2 bHLH_TS_FIGLA 3..58 CDD:381428 23/65 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_114727
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.