DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and hlh-4

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001379052.1 Gene:hlh-4 / 176372 WormBaseID:WBGene00001951 Length:205 Species:Caenorhabditis elegans


Alignment Length:66 Identity:26/66 - (39%)
Similarity:36/66 - (54%) Gaps:10/66 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDL 165
            |.:||||||.||..||.:|..|:||:|.  :...|        |::||:..|..|:.||..|..|
 Worm     5 VAKRNARERTRVHTVNQAFLVLKQHLPS--LRQFT--------KRVSKLRILNAAITYIDTLLKL 59

  Fly   166 V 166
            :
 Worm    60 I 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 22/57 (39%)
hlh-4NP_001379052.1 bHLH_TS_ASCL 5..60 CDD:381424 25/64 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.