powered by:
Protein Alignment sc and hlh-4
DIOPT Version :9
Sequence 1: | NP_476803.1 |
Gene: | sc / 30982 |
FlyBaseID: | FBgn0004170 |
Length: | 345 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001379052.1 |
Gene: | hlh-4 / 176372 |
WormBaseID: | WBGene00001951 |
Length: | 205 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 26/66 - (39%) |
Similarity: | 36/66 - (54%) |
Gaps: | 10/66 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 101 VQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDL 165
|.:||||||.||..||.:|..|:||:|. :...| |::||:..|..|:.||..|..|
Worm 5 VAKRNARERTRVHTVNQAFLVLKQHLPS--LRQFT--------KRVSKLRILNAAITYIDTLLKL 59
Fly 166 V 166
:
Worm 60 I 60
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13935 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.