DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and hlh-3

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_495938.4 Gene:hlh-3 / 174447 WormBaseID:WBGene00001950 Length:170 Species:Caenorhabditis elegans


Alignment Length:182 Identity:52/182 - (28%)
Similarity:76/182 - (41%) Gaps:58/182 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKG 137
            |.|..:.|.|:..|.||.:...   .|:.|:||.|||.||.|||..|..|::.:|::        
 Worm     3 ASTSSTPSTSTKIPSSSKSSVT---KQTKQKRNERERKRVDQVNQGFVLLQERVPKA-------- 56

  Fly   138 GGRGPHKKISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNA------------VTQLQLC--- 187
              .|...|:|||:|||.|..||:.||..:    |.|:...:|:            |....:|   
 Worm    57 --AGNKAKLSKVETLREAARYIQELQKQL----GMSSTSFHNSMPADFPTPEQSPVYPQSVCSMM 115

  Fly   188 ----------------------LDESSSH----SSSSSTCSSSGHNTYYQNT 213
                                  ..:.|||    |||||..:|..|:::|.:|
 Worm   116 AQTPSPSYTSPYYPPPQMMSSNQHDMSSHYYQESSSSSASTSGDHHSFYSHT 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 23/57 (40%)
hlh-3NP_495938.4 HLH 32..83 CDD:197674 25/60 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I7414
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4106
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - otm14646
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.