DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Mesp2

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_032615.2 Gene:Mesp2 / 17293 MGIID:1096325 Length:370 Species:Mus musculus


Alignment Length:360 Identity:77/360 - (21%)
Similarity:124/360 - (34%) Gaps:161/360 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NQNQPAGTMP-IKTRKYT-PRGMALTRCSESVSSLSP-GSSPAPYNVDQSQSVQRRNARERNRVK 113
            :.:..:|:.| ..||:.: |.|.|  |.:.:..:.:| .:.|||.. .|.||.   :.||:.|::
Mouse    35 SSSDSSGSCPCYATRRPSQPAGPA--RSTRTTQATAPRRTRPAPAG-GQRQSA---SEREKLRMR 93

  Fly   114 QVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLV----DDL----- 169
            .:..:...||:.:|.|:    ...|     :.::|::|||:|:.||..|..|:    |.|     
Mouse    94 TLARALQELRRFLPPSV----APAG-----QSLTKIETLRLAIRYIGHLSALLGLSEDSLRRRRR 149

  Fly   170 ---------------NGGS-----------------------------------NIGANNAVT-- 182
                           :|||                                   |:|  |.::  
Mouse   150 RSADAAFSHRCPQCPDGGSPSQAQMLGPSLGSAMSSGVSWGCPPACPGPLISPENLG--NRISNV 212

  Fly   183 ----------QLQLCLDESSSHSSSSS------TC----------SSSGHNT----------YYQ 211
                      |:|..|.:|...::.||      .|          :.:||.|          .||
Mouse   213 DPWVTPPYCPQIQSPLHQSLERAADSSPWAPPQACPGMQMSPEPRNKTGHWTQSTEPAELTKVYQ 277

  Fly   212 NTISVSP----------LQQQQQLQRQQFNHQPLTALSLNTNLVGTSVP-----GGDAGCVSTSK 261
             ::||||          |..:...||.|...||              .|     |.||..:|||:
Mouse   278 -SLSVSPEPCLSLGSPLLLPRPSCQRLQPQPQP--------------QPQWGCWGHDAEVLSTSE 327

  Fly   262 NQQT-------CHSPTSSFNSSMSFDSGTYEGVPQ 289
            :|.:       ..|||.|....:|       |.|:
Mouse   328 DQGSSPALQLPVASPTPSSGLQLS-------GCPE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 15/57 (26%)
Mesp2NP_032615.2 HLH 80..133 CDD:278439 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.