DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Ascl2

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_032580.2 Gene:Ascl2 / 17173 MGIID:96920 Length:263 Species:Mus musculus


Alignment Length:237 Identity:73/237 - (30%)
Similarity:97/237 - (40%) Gaps:76/237 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 HIMPAPSP---------------------LIPGG-------NQNQPAGTMPIKTRKYTPRGMALT 75
            |..|.|.|                     |:.||       ..:..||....:.|:.:|.   |.
Mouse    39 HFPPHPVPREHFSCAAPELVAGAQGLNASLMDGGALPRLMPTSSGVAGACAARRRQASPE---LL 100

  Fly    76 RCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGR 140
            |||....|   |::.|.   ..|.:|.|||.|||||||.||..|..||||:|..           
Mouse   101 RCSRRRRS---GATEAS---SSSAAVARRNERERNRVKLVNLGFQALRQHVPHG----------- 148

  Fly   141 GPHKKISKVDTLRIAVEYIRRLQDLVDD-------LNGGSNIGANNAVTQLQLCLDESSSHSSSS 198
            |.:||:|||:|||.||||||.||.|:.:       |.||.   ...|......|...|:|.:|:|
Mouse   149 GANKKLSKVETLRSAVEYIRALQRLLAEHDAVRAALAGGL---LTPATPPSDECAQPSASPASAS 210

  Fly   199 STCSS--------------SGHNTYYQNTIS----VSPLQQQ 222
            .:|:|              |..:.|.....|    :||::|:
Mouse   211 LSCASTSPSPDRLGCSEPTSPRSAYSSEESSCEGELSPMEQE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 31/57 (54%)
Ascl2NP_032580.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..126 8/27 (30%)
HLH 134..176 CDD:197674 26/52 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..248 10/53 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848572
Domainoid 1 1.000 67 1.000 Domainoid score I9760
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5162
Isobase 1 0.950 - 0 Normalized mean entropy S6123
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm11115
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.700

Return to query results.
Submit another query.