DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Ascl1

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_032579.2 Gene:Ascl1 / 17172 MGIID:96919 Length:231 Species:Mus musculus


Alignment Length:189 Identity:64/189 - (33%)
Similarity:94/189 - (49%) Gaps:31/189 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PAPSPLI---PGGNQNQPAGTMPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQ--SV 101
            |..||:.   |.|..::.|.....:.|..:|.   |.||...::....|     |::.|.|  :|
Mouse    59 PQLSPVADSQPSGGGHKSAAKQVKRQRSSSPE---LMRCKRRLNFSGFG-----YSLPQQQPAAV 115

  Fly   102 QRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLV 166
            .|||.|||||||.||..||.||:|:|..           ..:||:|||:|||.||||||.||.|:
Mouse   116 ARRNERERNRVKLVNLGFATLREHVPNG-----------AANKKMSKVETLRSAVEYIRALQQLL 169

  Fly   167 DDLNGGSNIGANNAVTQL-QLCLDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQQQ 224
            |:.:      |.:|..|. .|....|.::|:..::.:.|..::|..:..|..||..::|
Mouse   170 DEHD------AVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 30/57 (53%)
Ascl1NP_032579.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..92 8/35 (23%)
HLH 129..171 CDD:197674 25/52 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9760
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5162
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm11115
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.