DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Lyl1

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_032561.2 Gene:Lyl1 / 17095 MGIID:96891 Length:278 Species:Mus musculus


Alignment Length:193 Identity:49/193 - (25%)
Similarity:71/193 - (36%) Gaps:63/193 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PAGTMPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRR---NARERNRVKQVNN 117
            |||...|     .|......|.|.|...|:.|..|        |.|.||   |:|||.|.:.||.
Mouse   116 PAGPFSI-----FPNSRLKRRPSHSELDLADGHQP--------QKVARRVFTNSRERWRQQHVNG 167

  Fly   118 SFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDD-------------- 168
            :||.||:.:|.           ..|.:|:||.:.||:|::||..|..|:.|              
Mouse   168 AFAELRKLLPT-----------HPPDRKLSKNEVLRLAMKYIGFLVRLLRDQTAVLTSGPSAPGS 221

  Fly   169 --------LNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQQ 223
                    :.|.:..||.:.|       :.:.|.......|....:.       ||.|::.:|
Mouse   222 RKPPARRGVEGSARFGAGHRV-------EAARSQPVLPGDCDGDPNG-------SVRPIKLEQ 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 21/57 (37%)
Lyl1NP_032561.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46
bHLH_TS_LYL1 145..209 CDD:381548 29/82 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..278 10/73 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.