DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and MESP2

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001035047.1 Gene:MESP2 / 145873 HGNCID:29659 Length:397 Species:Homo sapiens


Alignment Length:124 Identity:29/124 - (23%)
Similarity:49/124 - (39%) Gaps:41/124 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MPAPSPLIPGGNQNQPAGTMPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRN 105
            :|.|.|........:.|.|.|.:.|                      :.||        ..||::
Human    51 LPQPQPPSCSSRAAEAAATTPRRAR----------------------TGPA--------GGQRQS 85

  Fly   106 A--RERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRL 162
            |  ||:.|::.:..:...||:.:|.|    |...|     :.::|::|||:|:.||..|
Human    86 ASEREKLRMRTLARALHELRRFLPPS----LAPAG-----QSLTKIETLRLAIRYIGHL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 18/60 (30%)
MESP2NP_001035047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..92 14/70 (20%)
HLH 82..135 CDD:278439 19/61 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..208
13 X 2 AA tandem repeats of G-Q 179..204
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..295
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..376
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.