DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and ASCL4

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_982260.3 Gene:ASCL4 / 121549 HGNCID:24311 Length:172 Species:Homo sapiens


Alignment Length:173 Identity:57/173 - (32%)
Similarity:88/173 - (50%) Gaps:24/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PAPSPLIPGGNQNQP---AGTMPIKTRKYTPRGMAL---TRCSE-SVSSLSPGSSPAPYNVD--- 96
            ||....:|...:..|   .||:|...|: .|..:||   ..|.| :.|..:.|....|..:|   
Human     6 PAERLALPYSLRTAPLGVPGTLPGLPRR-DPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAF 69

  Fly    97 QSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRR 161
            :...:::||.|||.||:.||..:||||.|:|:.:           ..|::|||:|||.|::||:.
Human    70 EPAFLRKRNERERQRVRCVNEGYARLRDHLPREL-----------ADKRLSKVETLRAAIDYIKH 123

  Fly   162 LQDLVDDLNGGSNIGANNAVTQLQL-CLDESSSHSSSSSTCSS 203
            ||:|::....|.. ||..||.|.:. |..:..|.:||:.:.||
Human   124 LQELLERQAWGLE-GAAGAVPQRRAECNSDGESKASSAPSPSS 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 24/57 (42%)
ASCL4NP_982260.3 bHLH_SF 66..129 CDD:412148 29/73 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..172 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41464
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.