DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Atoh1

DIOPT Version :10

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_031526.1 Gene:Atoh1 / 11921 MGIID:104654 Length:351 Species:Mus musculus


Alignment Length:273 Identity:68/273 - (24%)
Similarity:97/273 - (35%) Gaps:81/273 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GGNQNQPAGTMPIKTRKYTPR---GMALTR--CSESVSSLSPGSSPAPYNVDQSQSVQRR---NA 106
            ||....|.   |:|.|:...:   |:.:..  ||..       .:|:...|:..|. |||   ||
Mouse   110 GGLSKSPG---PVKVREQLCKLKGGVVVDELGCSRQ-------RAPSSKQVNGVQK-QRRLAANA 163

  Fly   107 RERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDDLNG 171
            |||.|:..:|::|.:||..|| |...|          ||:||.:||::|..||..|.:|:...|.
Mouse   164 RERRRMHGLNHAFDQLRNVIP-SFNND----------KKLSKYETLQMAQIYINALSELLQTPNV 217

  Fly   172 GS-----NIGANNAVTQLQLCLDESSSHSSS-------------------------SSTCSSSGH 206
            |.     .....|....|:..........:|                         |...||.|:
Mouse   218 GEQPPPPTASCKNDHHHLRTASSYEGGAGASAVAGAQPAPGGGPRPTPPGPCRTRFSGPASSGGY 282

  Fly   207 NTYYQNTISVSPLQQQQQLQRQQFNHQPLTALSLNTNLVGTSVPGGDAGCV--STSKNQQTCH-- 267
            :.            |...|....|..:.|||:....:| ..|:|||....|  ..||.....|  
Mouse   283 SV------------QLDALHFPAFEDRALTAMMAQKDL-SPSLPGGILQPVQEDNSKTSPRSHRS 334

  Fly   268 ----SPTSSFNSS 276
                ||.|.::.|
Mouse   335 DGEFSPHSHYSDS 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 bHLH_TS_dAS-C_like 100..166 CDD:381587 27/68 (40%)
Atoh1NP_031526.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..116 2/5 (40%)
bHLH_TS_ATOH1 152..215 CDD:381556 29/74 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..278 2/33 (6%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..351 13/41 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.