DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and Ptf1a

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_446416.1 Gene:Ptf1a / 117034 RGDID:621709 Length:326 Species:Rattus norvegicus


Alignment Length:278 Identity:67/278 - (24%)
Similarity:102/278 - (36%) Gaps:99/278 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IMPAPS--------PLIPGGNQNQP---------AGTMPIKTRKYTPRGMALTRCSESVSSLSPG 87
            :.||||        |  |.|:..:|         ||. |:....|:|............:.||||
  Rat    70 LQPAPSAAPHALAPP--PLGDPGEPEDSGSYCCDAGA-PLGAFPYSPGSPPSCLAYPCTAVLSPG 131

  Fly    88 SSPAPYN-------------------VDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSIITD 133
            :.....|                   .:..|..|..|.|||.|::.:|::|..||.|||..    
  Rat   132 TRLRGLNGAAAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTL---- 192

  Fly   134 LTKGGGRGPH-KKISKVDTLRIAVEYIRRLQDLVD-DL-------------NGGSNIGANNAVTQ 183
                    |: |::|||||||:|:.||..|.:||. ||             .|..::|.::...|
  Rat   193 --------PYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGTGGCGGPGGSRHLGGDSPGNQ 249

  Fly   184 LQ---LCLDESSSHSSSSSTCSS---------SGHNTYY--------QNTISVSPL---QQQQQL 225
            .|   :|      |..:.|...|         :||:..:        ||.|..:.:   :..::|
  Rat   250 AQKVIIC------HRGTRSPSPSDPDYGLPPLAGHSLSWADEKQLKEQNIIRTAKVWTPEDPRKL 308

  Fly   226 QRQQF----NHQPLTALS 239
            ..:.|    |..|...:|
  Rat   309 NSKSFDNIENEPPFEFVS 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 24/58 (41%)
Ptf1aNP_446416.1 bHLH_TS_PTF1A 164..218 CDD:381423 26/65 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..249 2/19 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..326 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.