DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and ptf1a

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_002933181.5 Gene:ptf1a / 100494161 XenbaseID:XB-GENE-484425 Length:270 Species:Xenopus tropicalis


Alignment Length:197 Identity:52/197 - (26%)
Similarity:81/197 - (41%) Gaps:55/197 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 CSESVSSLSPGSSPAPY----------NVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSII 131
            |.|....||||......          :.:..|..|..|.|||.|::.:|::|..||.|||..  
 Frog    87 CGEGGCELSPGMKGGSLVMKRRRRLRSDAEMQQLRQAANVRERRRMQSINDAFEGLRSHIPTL-- 149

  Fly   132 TDLTKGGGRGPH-KKISKVDTLRIAVEYIRRLQDLV-DDLN-GGSNIGANNAVTQLQLCLDESSS 193
                      |: |::|||||||:|:.||..|.:|| .||. ...|..:.:...::.:|      
 Frog   150 ----------PYEKRLSKVDTLRLAIGYINFLSELVQSDLPLRNPNTDSGHQPKKVIIC------ 198

  Fly   194 HSSSSSTCSS---------SGHNTYY--------QNTISVSPL---QQQQQLQRQQF----NHQP 234
            |..:.|...|         :||:..:        ||.:..:.:   :..::|.:..|    |..|
 Frog   199 HRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLRDQNVVRTAKVWTPEDPRKLNKSSFSNIENEPP 263

  Fly   235 LT 236
            ||
 Frog   264 LT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 24/58 (41%)
ptf1aXP_002933181.5 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.