DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and ascl1

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_002944648.3 Gene:ascl1 / 100490701 XenbaseID:XB-GENE-1032967 Length:199 Species:Xenopus tropicalis


Alignment Length:213 Identity:69/213 - (32%)
Similarity:98/213 - (46%) Gaps:42/213 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NSATKIF--------RYQHIMPAPSPLIPGGNQNQPA----GTMPIKTRKYTPRGMALTRCSESV 81
            |||..|.        :.||.: .|:...|...|..||    ...|.:.::.......|.||...:
 Frog     3 NSAANIMESNLSGQQQQQHFL-QPACFFPQNVQLSPAEEHEAAKPKQIKRQRSSSPELMRCKRRL 66

  Fly    82 SSLSPGSSPAPYNVDQSQ--SVQRRNARERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHK 144
            :....|     |::.|.|  :|.|||.|||||||.||..||.||:|:|..           ..:|
 Frog    67 NFTGFG-----YSLPQQQPAAVARRNERERNRVKLVNLGFATLREHVPNG-----------AANK 115

  Fly   145 KISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNAVTQ---LQLCLDESSSHSSSSSTCSSSGH 206
            |:|||:|||.||||||.||.|:|:.:      |.:|..|   |...:..:.||..:|  .:.|..
 Frog   116 KMSKVETLRSAVEYIRALQQLLDEHD------AVSAAFQSGVLSPTISPNYSHDMNS--MAGSPV 172

  Fly   207 NTYYQNTISVSPLQQQQQ 224
            ::|..:..|..||..::|
 Frog   173 SSYSSDEGSYDPLSPEEQ 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 30/57 (53%)
ascl1XP_002944648.3 bHLH_TS_ASCL1_Mash1 78..148 CDD:381585 40/86 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9148
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I4952
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm9527
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.