DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and ascl3

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_004913964.2 Gene:ascl3 / 100490616 XenbaseID:XB-GENE-6257824 Length:193 Species:Xenopus tropicalis


Alignment Length:150 Identity:48/150 - (32%)
Similarity:68/150 - (45%) Gaps:47/150 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 YTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRRNARERNRVKQVNNSFARLRQHIPQSII 131
            |.|....|..|..|       |.||        .:::||.|||.||:.||..:||||||:|..: 
 Frog    69 YIPFQNQLGLCDYS-------SEPA--------FIRKRNERERERVRCVNEGYARLRQHLPLEL- 117

  Fly   132 TDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGA---------NNAVTQLQ-- 185
                      ..|::|||:|||.|:|||:.||:::|       :|.         :|..|.:.  
 Frog   118 ----------AEKRLSKVETLRAAIEYIKHLQNILD-------LGTLRPPVTEPFSNTETSISPV 165

  Fly   186 LCLDESSS---HSSSSSTCS 202
            |.|...||   |.:..|.|:
 Frog   166 LYLSTKSSIQRHCAMGSPCT 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 26/57 (46%)
ascl3XP_004913964.2 bHLH_SF 80..143 CDD:412148 33/88 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14093
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.