Sequence 1: | NP_476803.1 | Gene: | sc / 30982 | FlyBaseID: | FBgn0004170 | Length: | 345 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001252512.1 | Gene: | mespab / 100006128 | ZFINID: | ZDB-GENE-090817-2 | Length: | 240 | Species: | Danio rerio |
Alignment Length: | 277 | Identity: | 55/277 - (19%) |
---|---|---|---|
Similarity: | 93/277 - (33%) | Gaps: | 110/277 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 PRGMALTRCS-ESVS-----------SLSPGSS------------------PAPYNVD------- 96
Fly 97 --------------QSQSVQRRNA--RERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKK 145
Fly 146 ISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSSSGHNTYY 210
Fly 211 QNTISVSPLQQQQQLQRQQFNHQP-LTALSLNTNLVGTSVPGGDAGCVSTSKNQQTCHSPTSSFN 274
Fly 275 SSMSF-------DSGTY 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sc | NP_476803.1 | HLH | 105..163 | CDD:278439 | 16/59 (27%) |
mespab | NP_001252512.1 | HLH | 91..144 | CDD:278439 | 17/61 (28%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |