DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sc and mespab

DIOPT Version :9

Sequence 1:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001252512.1 Gene:mespab / 100006128 ZFINID:ZDB-GENE-090817-2 Length:240 Species:Danio rerio


Alignment Length:277 Identity:55/277 - (19%)
Similarity:93/277 - (33%) Gaps:110/277 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PRGMALTRCS-ESVS-----------SLSPGSS------------------PAPYNVD------- 96
            |..:...||. |.:|           ||||.||                  |...|||       
Zfish     7 PYLLQAARCKLEPISSADCGYFSACGSLSPSSSIDSGCFSPPWGAGRQLEGPENANVDCLQAKKL 71

  Fly    97 --------------QSQSVQRRNA--RERNRVKQVNNSFARLRQHIPQSIITDLTKGGGRGPHKK 145
                          ::..::|::|  ||:.|::.:..:...||..:|.|:    ...|     :.
Zfish    72 KLALPVDSKRRSRSKNPGMKRQSASEREKLRMRDLTKALHHLRSFLPPSV----APAG-----QT 127

  Fly   146 ISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNAVTQLQLCLDESSSHSSSSSTCSSSGHNTYY 210
            ::|::|||:|:.||..|.|.:....          |...::|.      |:.:|....||  ..:
Zfish   128 LTKIETLRLAISYISHLSDQLRQAE----------VPNYEMCC------SAEASDRFQSG--LVF 174

  Fly   211 QNTISVSPLQQQQQLQRQQFNHQP-LTALSLNTNLVGTSVPGGDAGCVSTSKNQQTCHSPTSSFN 274
            :|..    :..||.|.:....:.| ||:...:...:..|.|.                  ||.|.
Zfish   175 ENVC----MDGQQGLMQDNVQYCPTLTSFGDSREQMENSFPA------------------TSHFR 217

  Fly   275 SSMSF-------DSGTY 284
            .:.|:       |..:|
Zfish   218 DAQSYMFPCTTMDDASY 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scNP_476803.1 HLH 105..163 CDD:278439 16/59 (27%)
mespabNP_001252512.1 HLH 91..144 CDD:278439 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.