DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and AT1G62975

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_683462.1 Gene:AT1G62975 / 842600 AraportID:AT1G62975 Length:259 Species:Arabidopsis thaliana


Alignment Length:146 Identity:33/146 - (22%)
Similarity:58/146 - (39%) Gaps:38/146 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGAN 71
            |.:..|||:..|.......:      ||.|.::|::.|.:||..:|...|    .|:|       
plant    62 NEANKNDDDRESKKMKHRDI------ERQRRQEVSSLFKRLRTLLPFQYI----QGKR------- 109

  Fly    72 KKLSKVSTLKMAVEYIRRLQ---KVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQ 133
               |....:..||.||:.||   |.|:|...:.:|.:....               ..|..::..
plant   110 ---STSDHIVQAVNYIKDLQIKIKELNEKRNRVKKVISATT---------------TTHSAIEEC 156

  Fly   134 SPTGSTSSCNSISSYC 149
            :.:.|:|:.:::||.|
plant   157 TSSLSSSAASTLSSSC 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 20/68 (29%)
AT1G62975NP_683462.1 bHLH_AtORG2_like 74..150 CDD:381484 22/110 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.