DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and bHLH38

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_191256.1 Gene:bHLH38 / 824864 AraportID:AT3G56970 Length:253 Species:Arabidopsis thaliana


Alignment Length:179 Identity:47/179 - (26%)
Similarity:77/179 - (43%) Gaps:44/179 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ESSSAFNGPSVIRR---NARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKV 77
            |.:...|.|.|:::   ||.||:|.|::|..||.||..:||:              ..:||||..
plant    60 EGNEIDNNPVVVKKLNHNASERDRRKKINTLFSSLRSCLPAS--------------DQSKKLSIP 110

  Fly    78 STLKMAVEYIRRLQKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSC 142
            .|:..:::||..||       ||.::.:..:::.|.....|:...||      ..|.|       
plant   111 ETVSKSLKYIPELQ-------QQVKRLIQKKEEILVRVSGQRDFELY------DKQQP------- 155

  Fly   143 NSISSYCKPATSTIPGATPPNNFHTKLEASFEDYRNNSCSS--GTEDED 189
            .:::||    .||: .||...:....::.|.....|.|.|:  |..:||
plant   156 KAVASY----LSTV-SATRLGDNEVMVQVSSSKIHNFSISNVLGGIEED 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 22/65 (34%)
bHLH38NP_191256.1 HLH 72..124 CDD:278439 20/65 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.