DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and BHLH100

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_181657.1 Gene:BHLH100 / 818723 AraportID:AT2G41240 Length:242 Species:Arabidopsis thaliana


Alignment Length:194 Identity:47/194 - (24%)
Similarity:79/194 - (40%) Gaps:51/194 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ENHSVFNDDEESSSAFNGPSVIRR---NARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIG 67
            ||.|    .|.:.:..:.|.|:::   ||.||.|.|::|..||.||..:|..             
plant    44 ENVS----SENNRTLLDNPVVMKKLNHNASERERRKKINTMFSSLRSCLPPT------------- 91

  Fly    68 PGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQL 132
             ...||||..:|:..|::||..|        |::.|:|..:::.|.||...|...:|.   :...
plant    92 -NQTKKLSVSATVSQALKYIPEL--------QEQVKKLMKKKEELSFQISGQRDLVYT---DQNS 144

  Fly   133 QSPTGSTSSCNSISSYCKPATSTIPGATPPNNFHTKLEASFEDYRNNSCS-----SGTEDEDIL 191
            :|..|.||..:::||              .....|::.......:...||     ||.|::.::
plant   145 KSEEGVTSYASTVSS--------------TRLSETEVMVQISSLQTEKCSFGNVLSGVEEDGLV 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 21/65 (32%)
BHLH100NP_181657.1 bHLH_AtORG2_like 62..136 CDD:381484 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.