DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and mespa

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001039184.1 Gene:mespa / 734031 XenbaseID:XB-GENE-920825 Length:310 Species:Xenopus tropicalis


Alignment Length:249 Identity:52/249 - (20%)
Similarity:89/249 - (35%) Gaps:76/249 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HSVFNDDEESSSAFNGPSV------------IRRNA--RERNRVKQVNNGFSQLRQHIPAAVIAD 58
            |:.|...|:..|.....|.            :|.:|  ||:.|::.:::....||:::|.||.. 
 Frog    65 HTAFTQMEKLKSKPQDTSTKKDQRNRKVYDRVRNSASEREKMRMRNLSSALQNLRRYLPPAVAP- 128

  Fly    59 LSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVL----------HENDQQKQKQLHL------ 107
                   ||    |.|:|:.||::.:.||..|.:||          .|.:.::....|:      
 Frog   129 -------IG----KTLTKIETLRLTIRYISHLSEVLGLDEETLIKRREEEMRRSNMCHIGLCCCQ 182

  Fly   108 QQQHLHFQQQQQHQH--------------------LYAWHQELQLQSPTGSTSSCNSISSYCKPA 152
            .:||....:.:.|..                    |.|..||.|..:...:....:.:..:.|..
 Frog   183 DRQHNLCSEARPHSSETVNLPYFSSSPRLFPEQNILEAQEQEFQQPARWATDGKASDLGDHMKSF 247

  Fly   153 TSTIPGATPPNNFHTKLEASFEDYRNNS--------CSSGTEDE-DILDYISLW 197
            :|....:.|.|:..||     ||:...|        |.:..:|. |.|....||
 Frog   248 SSCALASEPVNSIDTK-----EDFTIPSPISPDQGFCQNFIDDMWDELQQKDLW 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 21/77 (27%)
mespaNP_001039184.1 bHLH_SF 97..160 CDD:381792 22/74 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.