DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ascl4

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001157086.1 Gene:Ascl4 / 67341 MGIID:1914591 Length:144 Species:Mus musculus


Alignment Length:78 Identity:32/78 - (41%)
Similarity:48/78 - (61%) Gaps:17/78 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PSVIR-RNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYI 87
            |:.:| ||.|||.||:.||.|:::||||:|..:              |.::||||.||:.|:.||
Mouse    58 PAFLRQRNERERQRVRCVNEGYARLRQHLPREL--------------AGQRLSKVETLRAAISYI 108

  Fly    88 RRLQKVL--HEND 98
            ::||::|  |..|
Mouse   109 KQLQELLERHRPD 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 27/67 (40%)
Ascl4NP_001157086.1 HLH 72..116 CDD:197674 21/57 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848563
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8863
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.