DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and ASCL5

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001257530.1 Gene:ASCL5 / 647219 HGNCID:33169 Length:206 Species:Homo sapiens


Alignment Length:141 Identity:41/141 - (29%)
Similarity:55/141 - (39%) Gaps:61/141 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVE 85
            |....:.:||.|||.|||.||.|:::||.|:|.|:              |.|:||||.||:.|:.
Human    80 FEPAFIQKRNERERQRVKCVNEGYARLRGHLPGAL--------------AEKRLSKVETLRAAIR 130

  Fly    86 YIRRLQKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK 150
            ||:.|                                     |||...:|.|||          .
Human   131 YIKYL-------------------------------------QELLSSAPDGST----------P 148

  Fly   151 PATSTIPGATP 161
            ||:..:||..|
Human   149 PASRGLPGTGP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 27/65 (42%)
ASCL5NP_001257530.1 HLH 89..141 CDD:197674 30/102 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158180
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41464
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.