DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ascl1

DIOPT Version :10

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_071779.1 Gene:Ascl1 / 64186 RGDID:71010 Length:233 Species:Rattus norvegicus


Alignment Length:173 Identity:57/173 - (32%)
Similarity:81/173 - (46%) Gaps:56/173 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRR 89
            :|.|||.|||||||.||.||:.||:|:|        ||      .||||:|||.||:.||||||.
  Rat   116 AVARRNERERNRVKLVNLGFATLREHVP--------NG------AANKKMSKVETLRSAVEYIRA 166

  Fly    90 LQKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCKPATS 154
            ||::|.|:|.....          ||              ..:.|||.|.:..|.::|.      
  Rat   167 LQQLLDEHDAVSAA----------FQ--------------AGVLSPTISPNYSNDLNSM------ 201

  Fly   155 TIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLW 197
                |..|.:.::..|.|::..       ..|::::||:.: |
  Rat   202 ----AGSPVSSYSSDEGSYDPL-------SPEEQELLDFTN-W 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 bHLH_TS_dAS-C_like 25..94 CDD:381587 38/68 (56%)
Ascl1NP_071779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..95
bHLH_TS_ASCL1_Mash1 112..182 CDD:381585 41/89 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.