DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ascl1

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_071779.1 Gene:Ascl1 / 64186 RGDID:71010 Length:233 Species:Rattus norvegicus


Alignment Length:173 Identity:57/173 - (32%)
Similarity:81/173 - (46%) Gaps:56/173 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRR 89
            :|.|||.|||||||.||.||:.||:|:|        ||      .||||:|||.||:.||||||.
  Rat   116 AVARRNERERNRVKLVNLGFATLREHVP--------NG------AANKKMSKVETLRSAVEYIRA 166

  Fly    90 LQKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCKPATS 154
            ||::|.|:|.....          ||              ..:.|||.|.:..|.::|.      
  Rat   167 LQQLLDEHDAVSAA----------FQ--------------AGVLSPTISPNYSNDLNSM------ 201

  Fly   155 TIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLW 197
                |..|.:.::..|.|::..       ..|::::||:.: |
  Rat   202 ----AGSPVSSYSSDEGSYDPL-------SPEEQELLDFTN-W 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 36/65 (55%)
Ascl1NP_071779.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..95
HLH 131..173 CDD:197674 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352165
Domainoid 1 1.000 67 1.000 Domainoid score I9554
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5061
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm9108
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2717
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.760

Return to query results.
Submit another query.