DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and hand2

DIOPT Version :10

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_571701.3 Gene:hand2 / 58150 ZFINID:ZDB-GENE-000511-1 Length:205 Species:Danio rerio


Alignment Length:102 Identity:28/102 - (27%)
Similarity:51/102 - (50%) Gaps:18/102 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NHSVFNDDEESSSAFNGPSVIRR----NARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIG 67
            :||.:.....:.:...||..::|    |.:||.|.:.:|:.|::||:.||              .
Zfish    66 DHSHYGGVPGAGAVGMGPRTVKRRPTANRKERRRTQSINSAFAELRECIP--------------N 116

  Fly    68 PGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQKQKQ 104
            ..|:.||||:.||::|..||..|..:|.:::|..:.:
Zfish   117 VPADTKLSKIKTLRLATSYIAYLMDILDKDEQNGETE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 bHLH_TS_dAS-C_like 25..94 CDD:381587 22/72 (31%)
hand2NP_571701.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..103 7/26 (27%)
bHLH_TS_HAND2 88..149 CDD:381477 23/74 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..194
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.