DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and mespba

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_571627.1 Gene:mespba / 58070 ZFINID:ZDB-GENE-000406-9 Length:236 Species:Danio rerio


Alignment Length:161 Identity:35/161 - (21%)
Similarity:64/161 - (39%) Gaps:52/161 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PSVIRRNA--RERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEY 86
            ||..|:||  :|:.|::.:......||..:||:|..            ..:.|:|:.||::.::|
Zfish    64 PSERRQNASEKEKLRMRDLTKALHHLRSFLPASVAP------------VGQTLTKIETLRLTIQY 116

  Fly    87 IRRLQKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCKP 151
            |..|           ..||.|.::.|.:::|:                   ::|.| |:||:  .
Zfish   117 ISFL-----------SSQLGLSEEELSYRRQE-------------------NSSGC-SLSSF--E 148

  Fly   152 ATSTIPGATPPNNFHTKLEASFEDYRNNSCS 182
            .:|...|.......:...:..:||     ||
Zfish   149 CSSVNGGFVGTEQGYALCDGQYED-----CS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 16/67 (24%)
mespbaNP_571627.1 HLH 67..120 CDD:278439 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.