DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ascl3

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_064435.1 Gene:Ascl3 / 56787 MGIID:1928820 Length:174 Species:Mus musculus


Alignment Length:82 Identity:33/82 - (40%)
Similarity:50/82 - (60%) Gaps:15/82 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GPSVIR-RNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEY 86
            ||:.|| ||.|||.|||.||.|:::||:|:|...:              .|:||||.||:.|::|
Mouse    90 GPAFIRKRNERERQRVKCVNEGYARLRRHLPEDYL--------------EKRLSKVETLRAAIKY 140

  Fly    87 IRRLQKVLHENDQQKQK 103
            |..||.:|:.::.:.:|
Mouse   141 ISYLQSLLYPDESETKK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 27/65 (42%)
Ascl3NP_064435.1 HLH 95..145 CDD:278439 26/63 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..174 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848561
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8863
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.