DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and mespb

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001016653.1 Gene:mespb / 549407 XenbaseID:XB-GENE-970939 Length:292 Species:Xenopus tropicalis


Alignment Length:224 Identity:45/224 - (20%)
Similarity:76/224 - (33%) Gaps:90/224 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RRNA--RERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRL 90
            |::|  ||:.|::.::.....||:::|.:| |.|           :|.|:|:.||::.:.||..|
 Frog    98 RQSASEREKLRMRNLSKALQNLRRYLPPSV-APL-----------DKTLTKIETLQLTISYISHL 150

  Fly    91 QKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCKPATST 155
                       ..||.|.::.|..::..:.|.                |:.|.|..|.|...|..
 Frog   151 -----------SAQLGLTEEILTQRRLAETQR----------------TNLCPSGFSCCMDPTHR 188

  Fly   156 I----------PGATPPNNF--------------------------HTKLEASFEDYRNNS---- 180
            :          |.|||...|                          ..|.|.:...|.:.|    
 Frog   189 LCTTPEEDHFNPAATPTMPFSEARCYPEPGYHGREAVCQQSCETPLQLKQEITSPQYADPSTMAK 253

  Fly   181 -----CSSGTED----EDILDYISLWQDD 200
                 |.:|.:.    ||..:...:|:.|
 Frog   254 PVRQQCITGLQHTIHCEDYYNLADIWRRD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 18/67 (27%)
mespbNP_001016653.1 HLH 97..150 CDD:278439 18/63 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.