Sequence 1: | NP_476824.1 | Gene: | ac / 30981 | FlyBaseID: | FBgn0000022 | Length: | 201 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001016653.1 | Gene: | mespb / 549407 | XenbaseID: | XB-GENE-970939 | Length: | 292 | Species: | Xenopus tropicalis |
Alignment Length: | 224 | Identity: | 45/224 - (20%) |
---|---|---|---|
Similarity: | 76/224 - (33%) | Gaps: | 90/224 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 RRNA--RERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRL 90
Fly 91 QKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCKPATST 155
Fly 156 I----------PGATPPNNF--------------------------HTKLEASFEDYRNNS---- 180
Fly 181 -----CSSGTED----EDILDYISLWQDD 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ac | NP_476824.1 | HLH | 30..96 | CDD:197674 | 18/67 (27%) |
mespb | NP_001016653.1 | HLH | 97..150 | CDD:278439 | 18/63 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |