DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ascl5

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_017454536.1 Gene:Ascl5 / 363991 RGDID:1561854 Length:188 Species:Rattus norvegicus


Alignment Length:74 Identity:31/74 - (41%)
Similarity:44/74 - (59%) Gaps:14/74 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVE 85
            |....:.:||.|||.|||.||.|:::||.|:|.|:              |.|:||||.||:.|:.
  Rat    77 FEPAFIQKRNERERQRVKCVNEGYARLRGHLPGAL--------------AEKRLSKVETLRAAIR 127

  Fly    86 YIRRLQKVL 94
            ||:.||::|
  Rat   128 YIKYLQELL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 29/65 (45%)
Ascl5XP_017454536.1 HLH 86..136 CDD:197674 28/63 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352163
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12323
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.