DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and MSGN1

DIOPT Version :10

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001099039.1 Gene:MSGN1 / 343930 HGNCID:14907 Length:193 Species:Homo sapiens


Alignment Length:80 Identity:21/80 - (26%)
Similarity:39/80 - (48%) Gaps:15/80 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SVIRR---NARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEY 86
            ||.||   :.||:.|::.:.:....||.::|...      .:||      :.|:|:.|||..::|
Human   122 SVQRRRKASEREKLRMRTLADALHTLRNYLPPVY------SQRG------QPLTKIQTLKYTIKY 174

  Fly    87 IRRLQKVLHENDQQK 101
            |..|..:|:...:.:
Human   175 IGELTDLLNRGREPR 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 bHLH_TS_dAS-C_like 25..94 CDD:381587 20/71 (28%)
MSGN1NP_001099039.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..59
bHLH_TS_Msgn1 118..183 CDD:381509 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.