DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Hand

DIOPT Version :10

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_609370.2 Gene:Hand / 34379 FlyBaseID:FBgn0032209 Length:174 Species:Drosophila melanogaster


Alignment Length:65 Identity:25/65 - (38%)
Similarity:33/65 - (50%) Gaps:14/65 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVL 94
            |.:||.|.:.:||.||.||:.||              ....:.||||:.|||:|:.||..|..||
  Fly    64 NKKERRRTQSINNAFSYLREKIP--------------NVPTDTKLSKIKTLKLAILYINYLVNVL 114

  Fly    95  94
              Fly   115  114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 bHLH_TS_dAS-C_like 25..94 CDD:381587 23/63 (37%)
HandNP_609370.2 bHLH_TS_HAND 59..114 CDD:381472 23/63 (37%)

Return to query results.
Submit another query.