powered by:
Protein Alignment ac and HLH4C
DIOPT Version :9
Sequence 1: | NP_476824.1 |
Gene: | ac / 30981 |
FlyBaseID: | FBgn0000022 |
Length: | 201 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001259243.1 |
Gene: | HLH4C / 31397 |
FlyBaseID: | FBgn0011277 |
Length: | 191 |
Species: | Drosophila melanogaster |
Alignment Length: | 63 |
Identity: | 24/63 - (38%) |
Similarity: | 34/63 - (53%) |
Gaps: | 14/63 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 RERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVL 94
|||.||:..|..|::||:.:|. :.| :|||||:..||:|:.||..|..||
Fly 116 RERIRVEAFNVSFAELRKLLPT------------LPP--DKKLSKIEILKLAICYIAYLNHVL 164
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ac | NP_476824.1 |
HLH |
30..96 |
CDD:197674 |
24/63 (38%) |
HLH4C | NP_001259243.1 |
HLH |
108..165 |
CDD:238036 |
24/63 (38%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.