DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and ascl1a

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_571294.1 Gene:ascl1a / 30466 ZFINID:ZDB-GENE-980526-90 Length:196 Species:Danio rerio


Alignment Length:173 Identity:58/173 - (33%)
Similarity:82/173 - (47%) Gaps:56/173 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRR 89
            :|.|||.|||||||.|||||:.||:|:|        ||      .||||:|||.||:.||||||.
Zfish    79 AVARRNERERNRVKLVNNGFATLREHVP--------NG------AANKKMSKVETLRSAVEYIRA 129

  Fly    90 LQKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCKPATS 154
            ||::|.|:|.....          ||.              .:.|||.|.:..|.::|.      
Zfish   130 LQQLLDEHDAVSAA----------FQS--------------GVLSPTISQNYSNDMNSM------ 164

  Fly   155 TIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLW 197
                |..|.:.::..|.|::..       ..|::::||:.: |
Zfish   165 ----AGSPVSSYSSDEGSYDPL-------SPEEQELLDFTN-W 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 37/65 (57%)
ascl1aNP_571294.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 33..54
HLH 94..136 CDD:197674 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..186 6/43 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594066
Domainoid 1 1.000 69 1.000 Domainoid score I9565
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I5117
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm6567
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 1 1.000 - - X2717
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.