DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ascl4

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:XP_038935995.1 Gene:Ascl4 / 299687 RGDID:1307533 Length:145 Species:Rattus norvegicus


Alignment Length:78 Identity:32/78 - (41%)
Similarity:48/78 - (61%) Gaps:17/78 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PSVIR-RNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYI 87
            |:.:| ||.|||.||:.||.|:::||||:|..:              |.::||||.||:.|:.||
  Rat    58 PAFLRQRNERERQRVRCVNEGYARLRQHLPREL--------------AGQRLSKVETLRAAIGYI 108

  Fly    88 RRLQKVL--HEND 98
            ::||::|  |..|
  Rat   109 KQLQELLERHRPD 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 27/67 (40%)
Ascl4XP_038935995.1 bHLH_SF 57..116 CDD:412148 29/71 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm12323
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13935
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.