DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ascl2

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_113691.1 Gene:Ascl2 / 24209 RGDID:2159 Length:260 Species:Rattus norvegicus


Alignment Length:85 Identity:46/85 - (54%)
Similarity:53/85 - (62%) Gaps:18/85 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVS 78
            :..||||    :|.|||.|||||||.||.||..||||:|..              |||||||||.
  Rat   112 EASSSSA----AVARRNERERNRVKLVNLGFQALRQHVPHG--------------GANKKLSKVE 158

  Fly    79 TLKMAVEYIRRLQKVLHEND 98
            ||:.||||||.||::|.|:|
  Rat   159 TLRSAVEYIRALQRLLAEHD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 37/65 (57%)
Ascl2NP_113691.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..126 8/17 (47%)
HLH 134..176 CDD:197674 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..239
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352167
Domainoid 1 1.000 67 1.000 Domainoid score I9554
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I5061
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1131543at2759
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm9108
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2717
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.850

Return to query results.
Submit another query.