DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ascl5

DIOPT Version :10

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001257538.1 Gene:Ascl5 / 226439 MGIID:2685043 Length:188 Species:Mus musculus


Alignment Length:74 Identity:30/74 - (40%)
Similarity:43/74 - (58%) Gaps:14/74 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVE 85
            |....:.:||.|||.|||.||.|:::||.|:|.|:              ..|:||||.||:.|:.
Mouse    77 FEPAFIQKRNERERQRVKCVNEGYARLRGHLPGAL--------------TEKRLSKVETLRAAIR 127

  Fly    86 YIRRLQKVL 94
            ||:.||::|
Mouse   128 YIKYLQELL 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 bHLH_TS_dAS-C_like 25..94 CDD:381587 28/68 (41%)
Ascl5NP_001257538.1 bHLH_TS_ASCL5 76..136 CDD:381590 29/72 (40%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 80..93 5/12 (42%)
Helix-loop-helix motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00981 94..132 19/51 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..188
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.