DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ptf1a

DIOPT Version :10

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_061279.2 Gene:Ptf1a / 19213 MGIID:1328312 Length:324 Species:Mus musculus


Alignment Length:65 Identity:23/65 - (35%)
Similarity:34/65 - (52%) Gaps:14/65 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVL 94
            |.|||.|::.:|:.|..||.|||....              .|:||||.||::|:.||..|.:::
Mouse   166 NVRERRRMQSINDAFEGLRSHIPTLPY--------------EKRLSKVDTLRLAIGYINFLSELV 216

  Fly    95  94
            Mouse   217  216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 bHLH_TS_dAS-C_like 25..94 CDD:381587 23/63 (37%)
Ptf1aNP_061279.2 bHLH_TS_PTF1A 162..216 CDD:381423 23/63 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..324
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.