DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and hlh-6

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_496070.1 Gene:hlh-6 / 188539 WormBaseID:WBGene00001952 Length:268 Species:Caenorhabditis elegans


Alignment Length:87 Identity:33/87 - (37%)
Similarity:49/87 - (56%) Gaps:24/87 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GP---SVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAV 84
            ||   ||.:||.|||.||:.||:|:.:||:|:|  |..|            .|::|||.||::|:
 Worm   169 GPYSSSVWKRNERERCRVRNVNDGYERLRKHLP--VHFD------------EKRISKVDTLRLAI 219

  Fly    85 EYIRRLQKVLHENDQQKQKQLH 106
            .||:.|..:|       :.:||
 Worm   220 RYIKHLDNLL-------RSELH 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 26/65 (40%)
hlh-6NP_496070.1 HLH 179..231 CDD:197674 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14646
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13935
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.