DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and hlh-13

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_508725.1 Gene:hlh-13 / 185980 WormBaseID:WBGene00001957 Length:147 Species:Caenorhabditis elegans


Alignment Length:131 Identity:34/131 - (25%)
Similarity:52/131 - (39%) Gaps:45/131 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKV 77
            :.||..:|         :.|||.|:..:|..|.:||.:||....              .|:|||:
 Worm    39 EPEERQTA---------SIRERKRMCSINVAFIELRNYIPTFPY--------------EKRLSKI 80

  Fly    78 STLKMAVEYIRRLQKVL---HENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGST 139
            .||.:|:.||..|..||   .::.|..||.:|:.:..                   |:.:|..||
 Worm    81 DTLNLAIAYINMLDDVLRTPEDSGQYIQKCVHMARTG-------------------QIGAPAWST 126

  Fly   140 S 140
            |
 Worm   127 S 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 22/68 (32%)
hlh-13NP_508725.1 HLH 43..93 CDD:278439 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.