DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and hlh-4

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001379052.1 Gene:hlh-4 / 176372 WormBaseID:WBGene00001951 Length:205 Species:Caenorhabditis elegans


Alignment Length:77 Identity:27/77 - (35%)
Similarity:40/77 - (51%) Gaps:13/77 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRL 90
            |.:||||||.||..||..|..|:||:|:.        |:     ..|::||:..|..|:.||..|
 Worm     5 VAKRNARERTRVHTVNQAFLVLKQHLPSL--------RQ-----FTKRVSKLRILNAAITYIDTL 56

  Fly    91 QKVLHENDQQKQ 102
            .|::..::...|
 Worm    57 LKLIQSSEAVPQ 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 24/65 (37%)
hlh-4NP_001379052.1 bHLH_TS_ASCL 5..60 CDD:381424 26/67 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.