DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and hlh-3

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_495938.4 Gene:hlh-3 / 174447 WormBaseID:WBGene00001950 Length:170 Species:Caenorhabditis elegans


Alignment Length:183 Identity:53/183 - (28%)
Similarity:72/183 - (39%) Gaps:52/183 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLK 81
            |.|:....:..:||.|||.||.|||.||..|::.:|.|.             |...|||||.||:
 Worm    19 SKSSVTKQTKQKRNERERKRVDQVNQGFVLLQERVPKAA-------------GNKAKLSKVETLR 70

  Fly    82 MAVEYIRRLQKVLHENDQQKQKQLHLQQQHLH------FQQQQQHQHLYAWHQELQLQSPTGSTS 140
            .|..||           |:.||||.:.....|      |...:              |||....|
 Worm    71 EAARYI-----------QELQKQLGMSSTSFHNSMPADFPTPE--------------QSPVYPQS 110

  Fly   141 SCNSISSYCKPATSTIPGATPP----NNFHTKLEASFEDYRNNSCSSGTEDED 189
            .|:.::....| :.|.|...||    :|.|   :.|...|:.:|.||.:...|
 Worm   111 VCSMMAQTPSP-SYTSPYYPPPQMMSSNQH---DMSSHYYQESSSSSASTSGD 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 25/65 (38%)
hlh-3NP_495938.4 HLH 32..83 CDD:197674 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I7414
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I4106
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - otm14646
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.950

Return to query results.
Submit another query.