DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Mesp2

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_032615.2 Gene:Mesp2 / 17293 MGIID:1096325 Length:370 Species:Mus musculus


Alignment Length:177 Identity:35/177 - (19%)
Similarity:70/177 - (39%) Gaps:58/177 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RRNA--RERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRL 90
            |::|  ||:.|::.:.....:||:.:|.:|..            |.:.|:|:.||::|:.||..|
Mouse    81 RQSASEREKLRMRTLARALQELRRFLPPSVAP------------AGQSLTKIETLRLAIRYIGHL 133

  Fly    91 QKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQ-----------ELQLQSPTGSTSSCNS 144
            ..:           |.|.:..|..::::.....:: |:           :.|:..|:..::..:.
Mouse   134 SAL-----------LGLSEDSLRRRRRRSADAAFS-HRCPQCPDGGSPSQAQMLGPSLGSAMSSG 186

  Fly   145 ISSYCKPA---------------TSTIPGATPP------NNFHTKLE 170
            :|..|.||               ::..|..|||      :..|..||
Mouse   187 VSWGCPPACPGPLISPENLGNRISNVDPWVTPPYCPQIQSPLHQSLE 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 17/67 (25%)
Mesp2NP_032615.2 HLH 80..133 CDD:278439 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.