DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ascl2

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_032580.2 Gene:Ascl2 / 17173 MGIID:96920 Length:263 Species:Mus musculus


Alignment Length:205 Identity:63/205 - (30%)
Similarity:85/205 - (41%) Gaps:78/205 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVS 78
            :..||||    :|.|||.|||||||.||.||..||||:|..              |||||||||.
Mouse   112 EASSSSA----AVARRNERERNRVKLVNLGFQALRQHVPHG--------------GANKKLSKVE 158

  Fly    79 TLKMAVEYIRRLQKVLHENDQQK-------------------QKQLHLQQQHLHFQQQQQHQHLY 124
            ||:.||||||.||::|.|:|..:                   |..                    
Mouse   159 TLRSAVEYIRALQRLLAEHDAVRAALAGGLLTPATPPSDECAQPS-------------------- 203

  Fly   125 AWHQELQLQSPTGSTSSCNSISSYCKPATSTIPGATP--PNNFHTKLEASFEDYRNNSCSSGTED 187
                    .||..::.||.|.|    |:...:..:.|  |.:.::..|:|.|.      .....:
Mouse   204 --------ASPASASLSCASTS----PSPDRLGCSEPTSPRSAYSSEESSCEG------ELSPME 250

  Fly   188 EDILDYISLW 197
            :::||: |.|
Mouse   251 QELLDF-SSW 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 37/65 (57%)
Ascl2NP_032580.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..126 8/17 (47%)
HLH 134..176 CDD:197674 29/55 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..248 13/91 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848569
Domainoid 1 1.000 67 1.000 Domainoid score I9760
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5162
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001993
OrthoInspector 1 1.000 - - mtm11115
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2717
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.840

Return to query results.
Submit another query.