DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and MESP2

DIOPT Version :10

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001035047.1 Gene:MESP2 / 145873 HGNCID:29659 Length:397 Species:Homo sapiens


Alignment Length:86 Identity:23/86 - (26%)
Similarity:44/86 - (51%) Gaps:15/86 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AFNGPSVIRRNA---RERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLK 81
            |..||:..:|.:   ||:.|::.:.....:||:.:|.:           :.| |.:.|:|:.||:
Human    74 ARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPS-----------LAP-AGQSLTKIETLR 126

  Fly    82 MAVEYIRRLQKVLHENDQQKQ 102
            :|:.||..|..||..:::..|
Human   127 LAIRYIGHLSAVLGLSEESLQ 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 bHLH_TS_dAS-C_like 25..94 CDD:381587 17/71 (24%)
MESP2NP_001035047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..92 6/17 (35%)
bHLH_TS_Mesp 82..146 CDD:381508 19/75 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..208
13 X 2 AA tandem repeats of G-Q 179..204
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 222..295
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..376
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.