DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and ASCL4

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_982260.3 Gene:ASCL4 / 121549 HGNCID:24311 Length:172 Species:Homo sapiens


Alignment Length:143 Identity:40/143 - (27%)
Similarity:62/143 - (43%) Gaps:42/143 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SAFNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMA 83
            |||....:.:||.|||.||:.||.|:::||.|:|..:              |:|:||||.||:.|
Human    67 SAFEPAFLRKRNERERQRVRCVNEGYARLRDHLPREL--------------ADKRLSKVETLRAA 117

  Fly    84 VEYIRRLQKVLHENDQQKQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSY 148
            ::||:.||::|...                           ||..|....:.....:.||| ...
Human   118 IDYIKHLQELLERQ---------------------------AWGLEGAAGAVPQRRAECNS-DGE 154

  Fly   149 CKPATSTIPGATP 161
            .|.:::..|.:.|
Human   155 SKASSAPSPSSEP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 27/65 (42%)
ASCL4NP_982260.3 bHLH_SF 66..129 CDD:412148 30/75 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..172 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158178
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41464
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13935
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3926
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.