DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ac and Ptf1a

DIOPT Version :9

Sequence 1:NP_476824.1 Gene:ac / 30981 FlyBaseID:FBgn0000022 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_446416.1 Gene:Ptf1a / 117034 RGDID:621709 Length:326 Species:Rattus norvegicus


Alignment Length:65 Identity:23/65 - (35%)
Similarity:34/65 - (52%) Gaps:14/65 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVL 94
            |.|||.|::.:|:.|..||.|||....              .|:||||.||::|:.||..|.:::
  Rat   168 NVRERRRMQSINDAFEGLRSHIPTLPY--------------EKRLSKVDTLRLAIGYINFLSELV 218

  Fly    95  94
              Rat   219  218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
acNP_476824.1 HLH 30..96 CDD:197674 23/65 (35%)
Ptf1aNP_446416.1 bHLH_TS_PTF1A 164..218 CDD:381423 23/63 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..249
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.